PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008237122.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 275aa    MW: 31345.6 Da    PI: 8.434
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008237122.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM146.21.8e-45141411127
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrF+Pt+eel+ +yL+k+v+ +k++l +vi+++d++k+ePwd+++k+k     +++wy Fs++dkky++g+r+nrat +g+Wkatg+dk +
  XP_008237122.1  14 VPPGFRFQPTEEELLLYYLRKRVSCEKIDL-DVIRDIDLTKLEPWDIQEKCKIgslPQNDWYLFSHKDKKYPSGTRTNRATIAGFWKATGRDKVI 107
                     69****************************.9***************964444334567************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyr 127
                     +s +g+ +gl+ktLvfy+grap+ge++dW+m ey+
  XP_008237122.1 108 YS-NGRPIGLRKTLVFYNGRAPHGERSDWLMYEYN 141
                     **.999****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-519170IPR003441NAC domain
PROSITE profilePS5100550.74414170IPR003441NAC domain
PfamPF023654.2E-2215141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MSSISVSVNG QCQVPPGFRF QPTEEELLLY YLRKRVSCEK IDLDVIRDID LTKLEPWDIQ  60
EKCKIGSLPQ NDWYLFSHKD KKYPSGTRTN RATIAGFWKA TGRDKVIYSN GRPIGLRKTL  120
VFYNGRAPHG ERSDWLMYEY NHIVSLFVSN AMGGAATEEE GWVVCHIFIK KKKNLKTLNS  180
PSNSSFNYMG INTGHMLDSY YDEGSLEQMF QQVERNCKEE NKAEVVKYDT KPLIYTSNQV  240
IGAPDPKSLH QIVSGLTSWA AFDRLIASQL NGHTA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-4471718169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008237122.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-106NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM5VJG31e-175M5VJG3_PRUPE; Uncharacterized protein
STRINGPOPTR_0014s10060.11e-106(Populus trichocarpa)
STRINGGLYMA07G05660.11e-105(Glycine max)
STRINGGLYMA16G02200.21e-105(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3987422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-100NAC family protein